PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj4g3v3114830.1
Common NameNAO1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family WOX
Protein Properties Length: 336aa    MW: 38611.2 Da    PI: 8.4779
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj4g3v3114830.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox69.83.3e-2254113357
                      --SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
         Homeobox   3 kRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57 
                      +R+++t+eql++Leel+++ +r+psae++++++++l    +++ ++V++WFqN++a+e++
  Lj4g3v3114830.1  54 SRWNPTPEQLRALEELYRRgTRTPSAEQIQQITAQLrrfgKIEGKNVFYWFQNHKARERQ 113
                      7*****************99**************************************97 PP

2Wus_type_Homeobox114.84.1e-3753115365
  Wus_type_Homeobox   3 rtRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65 
                        ++RW+PtpeQ++ Leely++G+rtP++e+iq+ita+L+++Gkie+kNVfyWFQN+kaRerqk+
    Lj4g3v3114830.1  53 SSRWNPTPEQLRALEELYRRGTRTPSAEQIQQITAQLRRFGKIEGKNVFYWFQNHKARERQKR 115
                        79***********************************************************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003899.5E-551118IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.603.4E-954113IPR009057Homeodomain-like
SuperFamilySSF466891.41E-1254119IPR009057Homeodomain-like
PfamPF000466.3E-2054113IPR001356Homeobox domain
CDDcd000863.25E-655115No hitNo description
PROSITE profilePS5007111.45159114IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 336 aa     Download sequence    Send to blast
MVGYNESGAE FNMADYPFNG RKLRPLMPRP IHLLASVTEQ NKREFNTPPV VVSSRWNPTP  60
EQLRALEELY RRGTRTPSAE QIQQITAQLR RFGKIEGKNV FYWFQNHKAR ERQKRRRQME  120
SEAEGPPRDF ESSHHDKKDL GASRTVFEVE QTKNNWPSST NCTSTLAEES VSIQSAAAKA  180
VVAAECSRTD GWLQFDEGEL QQQRRNFMER NATWRMMQFP CPPQPPHFIN TPPQYASTTS  240
MATVTAARLM DQKLIKTHAD LSFFISPHTR ENNSIIHLSS FTTEDNVESQ TLQLFPLRNG  300
DGSSENSNQH HKETEISVSA MNAPSQFFEF LPLKKY
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Lja.258900.0pod
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJQ2912500.0JQ291250.1 Lotus japonicus NARROW ORGAN 1 (NAO1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003525189.11e-163PREDICTED: WUSCHEL-related homeobox 1-like isoform X1
TrEMBLJ7JYT70.0J7JYT7_LOTJA; NARROW ORGAN 1
STRINGGLYMA05G33850.21e-162(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF28923471
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18010.19e-59WUSCHEL related homeobox 1
Publications ? help Back to Top
  1. Zhuang LL, et al.
    LATHYROIDES, encoding a WUSCHEL-related Homeobox1 transcription factor, controls organ lateral growth, and regulates tendril and dorsal petal identities in garden pea (Pisum sativum L.).
    Mol Plant, 2012. 5(6): p. 1333-45
    [PMID:22888154]